General Information

  • ID:  hor002794
  • Uniprot ID:  P07712
  • Protein name:  Luqin
  • Gene name:  NA
  • Organism:  Aplysia californica (California sea hare)
  • Family:  NA
  • Source:  animal
  • Expression:  Neurons L2-4 and L6, also called giant dorsal LUQ (Left Upper Quadrant) neurons of the abdominal ganglion. Also expressed in smaller neurons in the CNS and in peripheral organs such as the kidney.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  APSWRPQGRF
  • Length:  10(24-33)
  • Propeptide:  MKTAVLLVCLAYVMAAILSLCASAPSWRPQGRFGKRTIPDRLPQTEESSLPDFGFSHLPALPLELFYNPRDLVHSGFRPRLCSVSGVEGYPPCVESHSDRKMKNLLDDLFGL
  • Signal peptide:  MKTAVLLVCLAYVMAAILSLCAS
  • Modification:  T10 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P07712-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002794_AF2.pdbhor002794_ESM.pdb

Physical Information

Mass: 136205 Formula: C55H80N18O13
Absent amino acids: CDEHIKLMNTVY Common amino acids: PR
pI: 12.5 Basic residues: 2
Polar residues: 2 Hydrophobic residues: 3
Hydrophobicity: -132 Boman Index: -3072
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 10
Instability Index: 8604 Extinction Coefficient cystines: 5500
Absorbance 280nm: 611.11

Literature

  • PubMed ID:  7784264
  • Title:  Processing of the L5-67 Precursor Peptide and Characterization of LUQIN in the LUQ Neurons of Aplysia Californica